PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054841.90
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 670aa    MW: 73547.5 Da    PI: 5.7369
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054841.90genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.55.3e-094154521954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  EcC054841.90 415 FEHflHPYPKDSDKILLARQTGLTRSQVSNWFINARVR 452
                   664459******************************88 PP

2BELL122.61.6e-39277348172
          BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   erqelq+k akL s+l+eVd+rYkqy+ q+q+v+ssF+++ag g+akpYt+lAl++iSrhFrcL+dai+ qi
  EcC054841.90 277 ERQELQSKLAKLSSMLDEVDRRYKQYYYQMQIVVSSFDVIAGPGAAKPYTALALQTISRHFRCLRDAITTQI 348
                   79********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.0E-62207346IPR006563POX domain
PfamPF075261.9E-50212345IPR006563POX domain
PROSITE profilePS5007112.05393456IPR001356Homeobox domain
SMARTSM003893.2E-9396460IPR001356Homeobox domain
CDDcd000867.33E-13396457No hitNo description
SuperFamilySSF466894.71E-17397463IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28399462IPR009057Homeodomain-like
PfamPF059202.6E-17413452IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0015979Biological Processphotosynthesis
GO:0031361Cellular Componentintegral component of thylakoid membrane
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003993Molecular Functionacid phosphatase activity
GO:0005506Molecular Functioniron ion binding
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0009055Molecular Functionelectron carrier activity
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 670 aa     Download sequence    Send to blast
MSTYYTSSSD QRDAAPVLYL REHAPTSHAE EPLLPGNNMS YVTSGFFSSA LTGNPQQQSN  60
GMDMSSVGGL DTMPQHQAMF SGLGGSQMSD HGLAGWRDGR NEMLFMQPMA SHSTVLQDGQ  120
NMQGQGLSLS LGTHIPSGIH IPSSQYQSQN LGLTAFLSPN SSKSAESNSR NGSTVDEQPR  180
SAEFFPQSLV GANQDLNTGN FSVNGMSNMS RMLSNSRYLR AAQQLLDEVV NVRKALKQSD  240
SEKIKKSEEG DEDSKKDTVS NPQESDGNST GDLSQAERQE LQSKLAKLSS MLDEVDRRYK  300
QYYYQMQIVV SSFDVIAGPG AAKPYTALAL QTISRHFRCL RDAITTQIQA TRKSLGEQDA  360
SGSSKGVGIP RLRFLDQQLR QQRALQQLGM MQQHAWRPQR GLPESSVSIL RAWLFEHFLH  420
PYPKDSDKIL LARQTGLTRS QVSNWFINAR VRLWKPMVEE MYKEEIGDAE MDSNSSSDTT  480
KPKTGDIKSS MEDRVEEVQQ SSTATQRCSS GQLMDSSFDR TPDVEMAGHS VGFNYLNGRH  540
RDVEAEYGQM KLNGEQAAVD NCGLFQNSMV QSGSNNDRFM AAAAAYQMAE MGRFGGGSGV  600
SLTLGLQHCE GGTLPVSTGA HSGFLAMRGD DMYNQAASSI GPETTEFESI NIGNQQQRFG  660
STQLLHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-16402459158Homeobox protein Meis1
4xrs_B2e-16402459158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028621.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_010028620.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_010028619.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLA0A059ANW60.0A0A059ANW6_EUCGR; Uncharacterized protein
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-120BEL1-like homeodomain 6